General Information

  • ID:  hor006566
  • Uniprot ID:  Q09627
  • Protein name:  Probable insulin-like peptide beta-type 2
  • Gene name:  ins-2
  • Organism:  Caenorhabditis elegans
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:1905910 negative regulation of dauer entry
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LCGRRLILFMLATCGECDTDSSEDLSHICCIKQCDVQDIIRVCCPNSFRK
  • Length:  50
  • Propeptide:  MNAIIFCLLFTTVTATYEVFGKGIEHRNEHLIINQLDIIPVESTPTPNRASRVQKRLCGRRLILFMLATCGECDTDSSEDLSHICCIKQCDVQDIIRVCCPNSFRK
  • Signal peptide:  MNAIIFCLLFTTVTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-30; 14-43; 17-44; 29-34
  • Structure ID:  AF-Q09627-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006566_AF2.pdbhor006566_ESM.pdb

Physical Information

Mass: 652787 Formula: C235H389N69O74S9
Absent amino acids: WY Common amino acids: C
pI: 5.67 Basic residues: 7
Polar residues: 17 Hydrophobic residues: 15
Hydrophobicity: 16.4 Boman Index: -8960
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 91.6
Instability Index: 7033.6 Extinction Coefficient cystines: 500
Absorbance 280nm: 10.2

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  9548970
  • Title:  New insulin-like proteins with atypical disulfide bond pattern characterized in Caenorhabditis elegans by comparative sequence analysis and homology modeling.